PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0157s0063.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 627aa    MW: 68949.6 Da    PI: 8.7804
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0157s0063.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B353.25.6e-1711102199
                          EEEE-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                          ffkv+   d   ++ l+lp kf+ ++  ++   ++++  l+d+s r+W+v++  +k  g + ++kGW++F ka++L+ gD+vvF++   +
  Kalax.0157s0063.1.p  11 FFKVM--IDEDFLRVLYLPPKFT-RIapDL--LKNTKTYLQDLSDRKWNVTV--SKENGLFAIKKGWSDFGKAHNLEIGDIVVFHYFPGR 93 
                          89999..555555679******9.674644..46678***************..999999*************************87434 PP

                          EE..EEEEE-S CS
                   B3  89 efelvvkvfrk 99 
                           f  +v++f++
  Kalax.0157s0063.1.p  94 YF--TVQIFNR 102
                          55..8999887 PP

2B341.22.9e-135546203199
                          .--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                   B3  31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                             k ++l+d  +r+W v +    k+++ +lt+GW+ F +an+++ gD ++Fk+  ++e+++ v+++rk
  Kalax.0157s0063.1.p 554 SDAKLVILRDAASRVWPVHY--YHKPSMKILTTGWSAFSQANKVQLGDECIFKVAPEEETTYDVSIVRK 620
                          456789**************..89999999***********************9888999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.39E-216105IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-188105IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.8589103IPR003340B3 DNA binding domain
CDDcd100179.42E-2010101No hitNo description
SMARTSM010195.1E-1511103IPR003340B3 DNA binding domain
PfamPF023621.6E-1411102IPR003340B3 DNA binding domain
SMARTSM010190.0015515621IPR003340B3 DNA binding domain
PROSITE profilePS5086311.674523621IPR003340B3 DNA binding domain
PfamPF023621.6E-10552620IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-12555619IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.26E-11556620IPR015300DNA-binding pseudobarrel domain
CDDcd100175.92E-9559619No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MGSLRETIVS FFKVMIDEDF LRVLYLPPKF TRIAPDLLKN TKTYLQDLSD RKWNVTVSKE  60
NGLFAIKKGW SDFGKAHNLE IGDIVVFHYF PGRYFTVQIF NRSACDVRNF GVDVGSTRKR  120
RRPEVIATDK NGKPAGNRDL DPLTVTPMES YKKGKREPAD FVVPMESNKR GKREPADFGD  180
ADIQFLMIDR NRVDEKREDR MVIDLSSYEM PNAEAKSVIQ QAANGSPVPH AGVLVKHEAE  240
PGSTDAGNYD LPAADIVSIV QWAGNGPLIP HAGALVKFKA EPASMEVANL KQEAKCDGVL  300
HESAKQMAID RSSHSDVKRE VHDTLAVGAP SRMTPMSPKY DAKSEVKKLS TAKPVVKIKK  360
EPGTQTSEET VIDLSNYKMS TADVKGSKEQ AGNRPSAPFA GSLVKCKAEP GSAEVSNIKQ  420
EMQCNAELPE WMKPVEIRRS SYAVVNRKVC EYDTTVAPGH TAPLVPKCDT NSDFLKLATP  480
KSGREAKTPY APGQSGNAFV KVKKEPQTET FEETGLALVT AGAGDLHCPI TSASSLFLEL  540
PASLPLFRLT SQTSDAKLVI LRDAASRVWP VHYYHKPSMK ILTTGWSAFS QANKVQLGDE  600
CIFKVAPEEE TTYDVSIVRK GSRPIS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117121RKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49475.11e-08B3 family protein